Iright
BRAND / VENDOR: Proteintech

Proteintech, 23968-1-AP, XKR6 Polyclonal antibody

CATALOG NUMBER: 23968-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The XKR6 (23968-1-AP) by Proteintech is a Polyclonal antibody targeting XKR6 in WB, ELISA applications with reactivity to human samples 23968-1-AP targets XKR6 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, Y79 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21104 Product name: Recombinant human XKR6 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 491-641 aa of BC024146 Sequence: MLLYYGVLHPTGPRAKILASSCCAELLWGIPLPPDVEPMAPEIPGYRGTQVTPTRAVTEQQEDLTADTCLPVFQVRPMGPPTPLGRPYLPEGPLIKIDMPRKRYPAWDAHFVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL Predict reactive species Full Name: XK, Kell blood group complex subunit-related family, member 6 Calculated Molecular Weight: 362aa,42 kDa; 641aa,72 kDa Observed Molecular Weight: 41-45 kDa GenBank Accession Number: BC024146 Gene Symbol: XKR6 Gene ID (NCBI): 286046 RRID: AB_2879381 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q5GH73 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924