Iright
BRAND / VENDOR: Proteintech

Proteintech, 23974-1-AP, EB3 Polyclonal antibody

CATALOG NUMBER: 23974-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EB3 (23974-1-AP) by Proteintech is a Polyclonal antibody targeting EB3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 23974-1-AP targets EB3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, fetal human brain tissue, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21148 Product name: Recombinant human MAPRE3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-281 aa of BC011557 Sequence: MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY Predict reactive species Full Name: microtubule-associated protein, RP/EB family, member 3 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 30-36 kDa GenBank Accession Number: BC011557 Gene Symbol: EB3 Gene ID (NCBI): 22924 RRID: AB_2879385 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9UPY8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924