Proteintech, 23994-1-AP, CLRN2 Polyclonal antibody

Size: 20ul / 150ul The CLRN2 (23994-1-AP) by Proteintech is a Polyclonal antibody targeting CLRN2 in WB, ELISA applications with reactivity to human, mouse samples 23994-1-AP targets CLRN2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse eye tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information Clarin 2 belongs to the clarin family of genes. It's a small integral membrane glycoproteins with four transmembrane domains. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21182 Product name: Recombinant human CLRN2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 149-232 aa of BC127863 Sequence: ALAIASFVAAVKFHDLTERIANFQEKLFQFVVVEEQYEESFWICVASASAHAANLVVVAISQIPLPEIKTKIEEATVTAEDILY Predict reactive species Full Name: clarin 2 Calculated Molecular Weight: 232 aa, 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC127863 Gene Symbol: CLRN2 Gene ID (NCBI): 645104 RRID: AB_2879393 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: A0PK11 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.