Proteintech, 23997-1-AP, AMPD3 Polyclonal antibody

Size: 20ul / 150ul The AMPD3 (23997-1-AP) by Proteintech is a Polyclonal antibody targeting AMPD3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 23997-1-AP targets AMPD3 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: RAW 264.7 cells, rat kidney tissue, HEK-293 cells, mouse kidney tissue, mouse lung tissue Positive IP detected in: mouse kidney tissue Positive IHC detected in: human colon tissue, mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21199 Product name: Recombinant human AMPD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-138 aa of BC126118 Sequence: MALSSEPAEMPRQFPKLNISEVDEQVRLLAEKVFAKVLREEDSKDALSLFTVPEDCPIGQKEAKERELQKELAEQKSVETAKRKKSFKMIRSQSLSLQMPPQQDWKGPPAASPAMSPTTPVVTGATSLPTPAPYAMPE Predict reactive species Full Name: adenosine monophosphate deaminase (isoform E) Calculated Molecular Weight: 776 aa, 90 kDa Observed Molecular Weight: 70 kDa, 90 kDa GenBank Accession Number: BC126118 Gene Symbol: AMPD3 Gene ID (NCBI): 272 RRID: AB_2879396 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q01432 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.