Iright
BRAND / VENDOR: Proteintech

Proteintech, 23999-1-AP, ANKRD29 Polyclonal antibody

CATALOG NUMBER: 23999-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ANKRD29 (23999-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD29 in WB, IP, ELISA applications with reactivity to human, mouse samples 23999-1-AP targets ANKRD29 in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21201 Product name: Recombinant human ANKRD29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 111-175 aa of BC030622 Sequence: DEGTALLAASQYGHMQVVETLLKHGANIHDQLYDGATALFLAAQGGYLDVIRLLLASGAKVNQPR Predict reactive species Full Name: ankyrin repeat domain 29 Calculated Molecular Weight: 301 aa, 33 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC030622 Gene Symbol: ANKRD29 Gene ID (NCBI): 147463 RRID: AB_2879398 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q8N6D5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924