Product Description
Size: 20ul / 150ul
The CEP89, CCDC123 (24002-1-AP) by Proteintech is a Polyclonal antibody targeting CEP89, CCDC123 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples
24002-1-AP targets CEP89, CCDC123 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: SH-SY5Y cells, Neuro-2a cells
Positive IF/ICC detected in: U-251 cells
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
CCDC123(as known as CEP123), also named as CEP89, is a new player in the process of primary ciliogenesis and it also plays a role in mitochondrial metabolism where it may modulate complex IV activity. It has been shown that CEP123 is localized to the distal appendages of the mother centriolecep and the localization of CEP123 is cell cycle-dependent with its levels decreasing during mitosis. CEP123 depletion can cause defects in ciliary vesicle formationcep and prevent the formation of a ciliary vesicle at the distal end of the mother centriole. It is possible that CEP123 is involved in regulating the recruitment of membranes to the centrosome through its interaction with Cep290(PMID:23575228, 23789104, 23348840). 24002-1-AP antibody recognizes all of CEP123 isoforms.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag21206 Product name: Recombinant human CCDC123 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 248-343 aa of BC136328 Sequence: MDLNNMNQSLTLELNTMKQAMKELQLKLKGMEKEKRKLKEAEKASSQEVAAPELLYLRKQAQELVDENDGLKMTVHRLNVELSRYQTKFRHLSKEE Predict reactive species
Full Name: coiled-coil domain containing 123
Calculated Molecular Weight: 783 aa, 90 kDa
Observed Molecular Weight: 85-100 kDa, 40 kDa
GenBank Accession Number: BC136328
Gene Symbol: CEP89
Gene ID (NCBI): 84902
RRID: AB_2879400
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96ST8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924