Proteintech, 24015-1-AP, MUTED/BLOC1S5 Polyclonal antibody

Size: 20ul / 150ul The MUTED/BLOC1S5 (24015-1-AP) by Proteintech is a Polyclonal antibody targeting MUTED/BLOC1S5 in WB, IF/ICC, ELISA applications with reactivity to human samples 24015-1-AP targets MUTED/BLOC1S5 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information BLOC1S5 (biogenesis of lysosomal organelles complex 1 subunit 5) encodes a subunit of the BLOC1, a complex that is involved in transport of some but not all cargo to the lysosome and lysosome-related organelles. BLOC1S5 has a crucial role in STING-mediated cell death upon stimulation with low concentrations of CMA(PMID: 29033128). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21226 Product name: Recombinant human MUTED protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC119644 Sequence: MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLENLKNMIHETNEHTLPKCRDTMRDSLSQVLQR Predict reactive species Full Name: muted homolog (mouse) Calculated Molecular Weight: 187 aa, 22 kDa Observed Molecular Weight: 22-25 kDa GenBank Accession Number: BC119644 Gene Symbol: MUTED Gene ID (NCBI): 63915 RRID: AB_2879402 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDH9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.