Proteintech, 24024-1-AP, B4GALNT2 Polyclonal antibody

Size: 20ul / 150ul The B4GALNT2 (24024-1-AP) by Proteintech is a Polyclonal antibody targeting B4GALNT2 in WB, IHC, ELISA applications with reactivity to human samples 24024-1-AP targets B4GALNT2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, COLO 320 cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:600-1:2400 Background Information B4GALNT2, also named as GALGT2, catalyzes the last step in the biosynthesis of the human Sd(a) antigen, which is found on more than 90% of Caucasian red blood cells. It also catalyzes the last step in the biosynthesis of the Cad antigen, which is related both serologically and biochemically to the Sd(a) antigen. B4GALNT2 transfers a beta-1,4-linked GalNAc to the galactose residue of an alpha-2,3-sialylated chain. This antibody detects the 55-65 kDa B4GALNT2 protein. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21166 Product name: Recombinant human B4GALNT2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 497-566 aa of BC113677 Sequence: HSEFFIDGLGTLLVGSCPEVIIGHQSRSPVVDSELAALEKTYNTYRSNTLTRVQFKLALHYFKNHLQCAA Predict reactive species Full Name: beta-1,4-N-acetyl-galactosaminyl transferase 2 Calculated Molecular Weight: 566 aa, 63 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC113677 Gene Symbol: B4GALNT2 Gene ID (NCBI): 124872 RRID: AB_2879405 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q8NHY0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.