Proteintech, 24027-1-AP, ANKRD39 Polyclonal antibody

Size: 20ul / 150ul The ANKRD39 (24027-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD39 in WB, IF/ICC, ELISA applications with reactivity to human samples 24027-1-AP targets ANKRD39 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, Transfected HEK-293 cells Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21210 Product name: Recombinant human ANKRD39 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-183 aa of BC031303 Sequence: MATPRPCADGPCCSHPSAVLGVQQTLEEMDFERGIWSAALNGDLGRVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTEITRLLLSHGSNPRVVDDDGMTSLHKAAERGHGDICSLLLQHSPALKAIRDRKARLACDLLPCNSDLRDLLSS Predict reactive species Full Name: ankyrin repeat domain 39 Calculated Molecular Weight: 183 aa, 20 kDa Observed Molecular Weight: 20-25 kDa GenBank Accession Number: BC031303 Gene Symbol: ANKRD39 Gene ID (NCBI): 51239 RRID: AB_2879407 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q53RE8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.