Iright
BRAND / VENDOR: Proteintech

Proteintech, 24036-1-AP, PCNA Polyclonal antibody

CATALOG NUMBER: 24036-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PCNA (24036-1-AP) by Proteintech is a Polyclonal antibody targeting PCNA in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 24036-1-AP targets PCNA in WB, IHC, IF-P, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse testis tissue, Raji cells, HEK-293 cells, NIH/3T3 cells, MCF-7 cells, rat liver tissue, HepG2 cells, Jurkat cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human breast cancer tissue, human gliomas tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human breast cancer tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:14000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information The proliferating cell nuclear antigen (PCNA), a protein synthesized in early G1 and S phases of the cell cycle, functions in cell cycle progression, DNA replication and DNA repair. In early S phase, PCNA exhibits granular distribution and is absent from the nucleoli; however, in late S phase, it relocates to the nucleoli. PCNA exists in two basic forms: one involved in ongoing DNA replication, which localizes specifically to the nucleus, and a second, soluble form, not implicated in constant synthesis. Interestingly, the latter form degrades in the presence of organic solvents, rendering it undetectable by histological methods in tissues using organic fixatives, and thus also providing a method of visualizing only the synthesizing form.This antibody specifically react with the 36kd human PCNA protein. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, rabbit, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7416 Product name: Recombinant human PCNA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 8-256 aa of BC000491 Sequence: QGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIE Predict reactive species Full Name: proliferating cell nuclear antigen Calculated Molecular Weight: 29 kDa/31 kDa Observed Molecular Weight: 36-38 kDa GenBank Accession Number: BC000491 Gene Symbol: PCNA Gene ID (NCBI): 5111 RRID: AB_2879414 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P12004 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924