Proteintech, 24091-1-AP, SPRED2 Polyclonal antibody

Size: 20ul / 150ul The SPRED2 (24091-1-AP) by Proteintech is a Polyclonal antibody targeting SPRED2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 24091-1-AP targets SPRED2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-12 cells, MCF-7 cells, mouse testis tissue, mouse brain tissue, rat brain tissue, T-47D cells, rat testis tissue Positive IHC detected in: rat testis tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SPRED2 is a member of the SPRED family of proteins that modulate GFR signaling by inhibiting the Ras-MAPK cascade (PMID: 17094949). SPRED family members are characterized by an N-terminal Enabled/VASP homology 1 domain (EVH1), a central c-Kit binding domain (KBD) and a C-terminal Sprouty-related domain (SPR) (PMID: 17691106). Three mammalian SPREDs (SPRED1-3) have been described. In adult tissues, SPRED2 is expressed ubiquitously, but most highly expressed in glandular epithelia (PMID: 15580519; 17691106). Reduced expression level of SPRED2 has been reported in human hepatocellular carcinoma (HCC), suggesting SPRED2 may play a role in tumorgenesis (PMID: 16652141). Gene disruption of SPRED2 causes dwarfism (PMID: 15946934). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21359 Product name: Recombinant human SPRED2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 122-214 aa of BC136334 Sequence: LIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMPRPYRQVSFPDDDEEI Predict reactive species Full Name: sprouty-related, EVH1 domain containing 2 Calculated Molecular Weight: 418 aa, 48 kDa Observed Molecular Weight: 40-48 kDa GenBank Accession Number: BC136334 Gene Symbol: SPRED2 Gene ID (NCBI): 200734 RRID: AB_2879429 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q7Z698 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.