Proteintech, 24133-1-AP, CYS1 Polyclonal antibody

Size: 20ul / 150ul The CYS1 (24133-1-AP) by Proteintech is a Polyclonal antibody targeting CYS1 in IHC, ELISA applications with reactivity to human samples 24133-1-AP targets CYS1 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19743 Product name: Recombinant human CYS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-158 aa of BC156921 Sequence: MGSGSSRSSRTLRRRRSPESLPAGPGAAALEGGTRRRVPVAAAEVPGAAAEEAPGRDPSPVAPPDGRDETLRLLDELLAESAAWGPPEPAPRRPARLRPTAVAGSAVCAEQSTEGHPGSGNVSEAPGSGRKKPERPAAISYDHSEEGLMASIEREYCR Predict reactive species Full Name: cystin 1 Calculated Molecular Weight: 158 aa, 16 kDa GenBank Accession Number: BC156921 Gene Symbol: CYS1 Gene ID (NCBI): 192668 RRID: AB_2879438 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q717R9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.