Iright
BRAND / VENDOR: Proteintech

Proteintech, 24162-1-AP, NPBWR2 Polyclonal antibody

CATALOG NUMBER: 24162-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NPBWR2 (24162-1-AP) by Proteintech is a Polyclonal antibody targeting NPBWR2 in IHC, ELISA applications with reactivity to human samples 24162-1-AP targets NPBWR2 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NPBWR1 (GPR7) and NPBWR2 (GPR8) are two structurally related G-protein coupled receptors. These two receptors share high sequence identity to each other and significant similarity with opioid and somatostatin receptors (PMID: 10407191). Neuropeptide B (NPB) and neuropeptide W (NPW) are endogenous peptide ligands of these receptors. NPBWR1 was found highly conserved in both human and rodents while NPBWR2 gene was not found in the rodent genomes (PMID: 7590751; 10407191). NPBWR1 and NPBWR2 are implicated in energy homeostasis, pain, and emotion (PMID: 23515889). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20874 Product name: Recombinant human NPBWR2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-211 aa of BC067481 Sequence: MQAAGHPEPLDSRGSFSLPTMGANVSQDNGTGHNATFSEPLPFLYVLLPAVYSGICAVGLTGNTAVILVILRAPKMKTVTNVFILNLAVADGLFTLVLPVNIAEHLLQYWPFGELLCKLVLAVDHYNIFSSIYFLAVMSVDRYLVVLATVRSRHMPWRTYRGAKVASLCVWLGVTVLVLPFFSFAGVYSNELQVPSCGLSFPWPEQVWFKA Predict reactive species Full Name: neuropeptides B/W receptor 2 Calculated Molecular Weight: 333 aa, 37 kDa GenBank Accession Number: BC067481 Gene Symbol: NPBWR2 Gene ID (NCBI): 2832 RRID: AB_2879442 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P48146 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924