Proteintech, 24207-1-AP, MBL Polyclonal antibody

Size: 20ul / 150ul The MBL (24207-1-AP) by Proteintech is a Polyclonal antibody targeting MBL in WB, IHC, ELISA applications with reactivity to human samples 24207-1-AP targets MBL in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human blood tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: human Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21508 Product name: Recombinant human MBL2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 21-248 aa of BC069338 Sequence: ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI Predict reactive species Full Name: mannose-binding lectin (protein C) 2, soluble (opsonic defect) Calculated Molecular Weight: 248 aa, 26 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC069338 Gene Symbol: MBL2 Gene ID (NCBI): 4153 RRID: AB_2879458 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P11226 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.