Proteintech, 24209-1-AP, COA6 Polyclonal antibody

Size: 20ul / 150ul The COA6 (24209-1-AP) by Proteintech is a Polyclonal antibody targeting COA6 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 24209-1-AP targets COA6 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse liver tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information C1orf31, also known as COA6, is a conserved mitochondrial protein required for respiratory complex IV biogenesis. Recently study reported that C1orf31 is required for maintenance of cytochrome c oxidase (CcO) subunit levels, and has role in the Cu delivery pathway to CcO. Defects in C1orf31 is associated with mitochondrial respiratory chain disease (MRCD). (24549041) Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21525 Product name: Recombinant human C1orf31 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 47-125 aa of BC116455 Sequence: MAAPSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTAKS Predict reactive species Full Name: chromosome 1 open reading frame 31 Calculated Molecular Weight: 125 aa, 14 kDa Observed Molecular Weight: 10 - 18 kDa GenBank Accession Number: BC116455 Gene Symbol: COA6 Gene ID (NCBI): 388753 RRID: AB_2879459 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q5JTJ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.