Iright
BRAND / VENDOR: Proteintech

Proteintech, 24274-1-AP, STAC2 Polyclonal antibody

CATALOG NUMBER: 24274-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The STAC2 (24274-1-AP) by Proteintech is a Polyclonal antibody targeting STAC2 in WB, IHC, ELISA applications with reactivity to human samples 24274-1-AP targets STAC2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SH-SY5Y cells Positive IHC detected in: human prostate hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17976 Product name: Recombinant human STAC2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 65-154 aa of BC109231 Sequence: TLRYGTSLALMNRSSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGPGDSASPVFTAPAESEGPGPEEKSPGQQLPKATLRKDVGPMYS Predict reactive species Full Name: SH3 and cysteine rich domain 2 Calculated Molecular Weight: 411 aa, 45 kDa Observed Molecular Weight: 42-45 kDa GenBank Accession Number: BC109231 Gene Symbol: STAC2 Gene ID (NCBI): 342667 RRID: AB_2879464 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZMT1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924