Proteintech, 24299-1-AP, GRAMD4 Polyclonal antibody

Size: 20ul / 150ul The GRAMD4 (24299-1-AP) by Proteintech is a Polyclonal antibody targeting GRAMD4 in WB, ELISA applications with reactivity to human samples 24299-1-AP targets GRAMD4 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information GRAMD4 also termed as Death inducing protein is a 578 amino-acid protein, which contains 1 GRAM domain. GRAMD4 as a multi-pass membrane protein localizes in the Mitochondrion membrane. Overexpression of GRAMD4 results in a strong apoptotic response involving caspase-3 activation and cleavage of poly(ADP-ribose)-polymerase. GRAMD4 is expressed in lung and in primary lung squamous cell carcinoma (LSCC) and shows up-regulation in mitochondria by E2F-1 after addition of 4-hydroxytamoxifen. This evidence suggests that GRAMD4 may be a potential target for cancer therapies. Full-length GRAMD4 expresses a protein of 66 kDa, whereas the 255 bp-deletion mutant expresses a protein of 56 kDa (PMID: 21127500). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19140 Product name: Recombinant human GRAMD4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 479-578 aa of BC129837 Sequence: PTDYIRNGVLYVTENYLCFESSKSGSSKRNKVIKLVDITDIQKYKVLSVLPGSGMGIAVSTPSTQKPLVFGAMVHRDEAFETILSQYIKITSAAASGGDS Predict reactive species Full Name: GRAM domain containing 4 Calculated Molecular Weight: 578 aa, 66 kDa Observed Molecular Weight: 56, 60 kDa GenBank Accession Number: BC129837 Gene Symbol: GRAMD4 Gene ID (NCBI): 23151 RRID: AB_2879482 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6IC98 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.