Iright
BRAND / VENDOR: Proteintech

Proteintech, 24313-1-AP, LYSMD3 Polyclonal antibody

CATALOG NUMBER: 24313-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LYSMD3 (24313-1-AP) by Proteintech is a Polyclonal antibody targeting LYSMD3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 24313-1-AP targets LYSMD3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Neuro-2a cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information LYSMD3 also termed as LysM and putative peptidoglycan binding domain containing protein 3 is a 306 amino acid single-pass membrane protein that contains one LysM repeat. LysM domain encoding genes may play a role in brain and in nervous system development and functioning. LYSMD3, shows a high level of central nervous expression during embryogenesis and is also, therefore, a good candidate gene for other central nervous system (CNS) symptoms, such as psychomotor retardation, brain anomalies and muscular hypotonia of the 5q14.3 microdeletion syndrome. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19430 Product name: Recombinant human LYSMD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC136741 Sequence: MAGRHQNRSFPLPGVQSSGQVHAFGNCSDSDILEEDAEVYELRSRGKEKVRRSTSRDRLDDIIVLTKDIQEGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTETLCPPKGRQTSRHSSVQYSSEQQ Predict reactive species Full Name: LysM, putative peptidoglycan-binding, domain containing 3 Calculated Molecular Weight: 306 aa, 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC136741 Gene Symbol: LYSMD3 Gene ID (NCBI): 116068 RRID: AB_2879490 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z3D4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924