Iright
BRAND / VENDOR: Proteintech

Proteintech, 24319-1-AP, C5orf24 Polyclonal antibody

CATALOG NUMBER: 24319-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C5orf24 (24319-1-AP) by Proteintech is a Polyclonal antibody targeting C5orf24 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples 24319-1-AP targets C5orf24 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human pancreas tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information C5orf24 is a cellular transcriptional regulator that performs different functions in different cell types, including the processes of cell proliferation, cell polarization, migration, and tumor development.C5orf24 is able to specifically and efficiently capture a wide range of tuberculosis antigens, which is important for the diagnosis of tuberculosis. C5orf24 has two isoforms with MW 20 kDa and 16 kDa. For phosphoserine modification, the MW is about 20-23 kDa. Specification Tested Reactivity: human Cited Reactivity: pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19534 Product name: Recombinant human C5orf24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC053677 Sequence: MMHPVASSNPAFCGPGKPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLNETHLQTTSGRSIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGRPPGS Predict reactive species Full Name: chromosome 5 open reading frame 24 Calculated Molecular Weight: 188 aa, 20 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC053677 Gene Symbol: C5orf24 Gene ID (NCBI): 134553 RRID: AB_2879491 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z6I8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924