Iright
BRAND / VENDOR: Proteintech

Proteintech, 24344-1-AP, ERP29 Polyclonal antibody

CATALOG NUMBER: 24344-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ERP29 (24344-1-AP) by Proteintech is a Polyclonal antibody targeting ERP29 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 24344-1-AP targets ERP29 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells, HEK-293 cells, HeLa cells, mouse kidney tissue, mouse liver tissue, mouse lung tissue, rat testis tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human liver cancer tissue, human breast cancer tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information Endoplasmic reticulum resident protein 29 (ERP29) is a 29-kDa endoplasmic reticulum (ER) luminal protein. Structurally ERp29 is related to protein disulfide isomerases (PDI). However, it lacks the thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase (PMID: 15500441). ERP29 plays an important role in the processing of secretory proteins within the (ER), possibly by participating in the folding of proteins in the ER. The secretion of thyroglobulin (TG) was found to be strongly regulated by ERP29 (PMID: 16380091). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19451 Product name: Recombinant human ERP29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-261 aa of BC101495 Sequence: PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL Predict reactive species Full Name: endoplasmic reticulum protein 29 Calculated Molecular Weight: 261 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC101495 Gene Symbol: ERP29 Gene ID (NCBI): 10961 RRID: AB_2879503 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30040 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924