Proteintech, 24347-1-AP, SHLD1 Polyclonal antibody

Size: 20ul / 150ul The SHLD1 (24347-1-AP) by Proteintech is a Polyclonal antibody targeting SHLD1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 24347-1-AP targets SHLD1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SHLD1, also known as FAM35A, is a key protein in the field of DNA damage repair. As a core component of the Shieldin complex, SHLD1 plays a critical role in maintaining genomic stability. Its primary function is to inhibit the resection of DNA double-strand break ends, directing repair toward the non-homologous end joining pathway while suppressing accurate homologous recombination repair. This function makes SHLD1 an important target for cancer therapy. In BRCA-mutant tumors, the expression level of SHLD1 directly affects the efficacy of PARP inhibitors-intact SHLD1 function renders cancer cells sensitive to the drugs, while its loss leads to drug resistance. Therefore, SHLD1 is not only a fundamental element in basic research on DNA damage response mechanisms but also a highly valuable tumor biomarker and prognostic indicator, offering new directions for personalized cancer treatment. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19727 Product name: Recombinant human C20orf196 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC035800 Sequence: MAARDATSGSLSEESSALDLPSACDIRDYVLQGPSQEANSEAFSSLEFHSFPYSSDVDPDTSNLNIEQNNSWTAENFWLDPAVKGQSEKEEDDGLRKSLDRFYEMFGHPQPGSANSLSASVCKCLSQKITQLRGQESQKYA Predict reactive species Full Name: chromosome 20 open reading frame 196 Calculated Molecular Weight: 205 aa, 23 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC035800 Gene Symbol: C20orf196 Gene ID (NCBI): 149840 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IYI0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.