Iright
BRAND / VENDOR: Proteintech

Proteintech, 24382-1-AP, VSTM1 Polyclonal antibody

CATALOG NUMBER: 24382-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The VSTM1 (24382-1-AP) by Proteintech is a Polyclonal antibody targeting VSTM1 in WB, IHC, ELISA applications with reactivity to human samples 24382-1-AP targets VSTM1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human peripheral blood leukocyte, HL-60 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information VSTM1 (V-set and transmembrane domain-containing protein 1) has two main splicing isoform, VSTM1-v1 and VSTM1-v2. VSTM1-v1 is a type I membrane molecule, mainly expressed on human peripheral blood granulocytes and monocytes. VSTM1-v2 is a classical secretory glycoprotein mainly expressed in immune tissues, and can promote the differentiation and activation of Th17 cells. (PMID: 22960280; 23909423) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15799 Product name: Recombinant human VSTM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-140 aa of BC100942 Sequence: CLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTIFVAI Predict reactive species Full Name: V-set and transmembrane domain containing 1 Calculated Molecular Weight: 236 aa, 26 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC100942 Gene Symbol: VSTM1 Gene ID (NCBI): 284415 RRID: AB_2879516 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UX27 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924