Iright
BRAND / VENDOR: Proteintech

Proteintech, 24407-1-AP, ACSM1 Polyclonal antibody

CATALOG NUMBER: 24407-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ACSM1 (24407-1-AP) by Proteintech is a Polyclonal antibody targeting ACSM1 in WB, ELISA applications with reactivity to human samples 24407-1-AP targets ACSM1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, LNCaP cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18475 Product name: Recombinant human ACSM1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 227-383 aa of BC125178 Sequence: SGTTGFPKMAKHSHGLALQPSFPGSRKLRSLKTSDVSWCLSDSGWIVATIWTLVEPWTAGCTVFIHHLPQFDTKVIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTGLLLYENYGQSETGLICATYWGMK Predict reactive species Full Name: acyl-CoA synthetase medium-chain family member 1 Calculated Molecular Weight: 577 aa, 65 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC125178 Gene Symbol: ACSM1 Gene ID (NCBI): 116285 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q08AH1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924