Iright
BRAND / VENDOR: Proteintech

Proteintech, 24411-1-AP, TFB2M Polyclonal antibody

CATALOG NUMBER: 24411-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TFB2M (24411-1-AP) by Proteintech is a Polyclonal antibody targeting TFB2M in WB, ELISA applications with reactivity to human, mouse samples 24411-1-AP targets TFB2M in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information TFB2M (mitochondrial transcription factor B2) is a novel nuclear-encoded protein that is necessary for transcription of mitochondrial DNA. Specification Tested Reactivity: human, mouse Cited Reactivity: human, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19687 Product name: Recombinant human TFB2M protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 176-396 aa of BC003383 Sequence: LGIEAVPWTADIPLKVVGMFPSRGEKRALWKLAYDLYSCTSIYKFGRIEVNMFIGEKEFQKLMADPGNPDLYHVLSVIWQLACEIKVLHMEPWSSFDIYTRKGPLENPKRRELLDQLQQKLYLIQMIPRQNLFTKNLTPMNYNIFFHLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLEDR Predict reactive species Full Name: transcription factor B2, mitochondrial Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC003383 Gene Symbol: TFB2M Gene ID (NCBI): 64216 RRID: AB_2879530 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H5Q4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924