Proteintech, 24422-1-AP, FAM168B Polyclonal antibody

Size: 20ul / 150ul The FAM168B (24422-1-AP) by Proteintech is a Polyclonal antibody targeting FAM168B in IHC, ELISA applications with reactivity to human samples 24422-1-AP targets FAM168B in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human cervical cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19535 Product name: Recombinant human FAM168B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-123 aa of BC066347 Sequence: MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAVPPYSSSPQAVPMSPCADQWARQLGQISGQPFVLLAGLLCWPHGEALESLMDCN Predict reactive species Full Name: family with sequence similarity 168, member B Calculated Molecular Weight: 195 aa, 20 kDa GenBank Accession Number: BC066347 Gene Symbol: FAM168B Gene ID (NCBI): 130074 RRID: AB_2879540 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A1KXE4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.