Proteintech, 24496-1-AP, Somatostatin (1-116aa) Polyclonal antibody

Size: 20ul / 150ul The Somatostatin (1-116aa) (24496-1-AP) by Proteintech is a Polyclonal antibody targeting Somatostatin (1-116aa) in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 24496-1-AP targets Somatostatin (1-116aa) in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse pancreas tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:4000-1:16000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Somatostatin is a peptide hormone that regulates the endocrine system and affects neurotransmission and cell proliferation via interaction with G protein-coupled somatostatin receptors and inhibition of the release of numerous secondary hormones. Somatostatin is a useful marker of D-cells of pancreatic islet cells. Somatostatin inhibits ins and glucagon secretion. Somatostatin has two active forms produced by alternative cleavage of a single preproprotein: one of 14 amino acids, the other of 28 amino acids. This antibody can recognize the full length and propeptide of Somatostatin. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21294 Product name: Recombinant human SST protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-116 aa of BC032625 Sequence: MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC Predict reactive species Full Name: somatostatin Calculated Molecular Weight: 13 kDa GenBank Accession Number: BC032625 Gene Symbol: Somatostatin Gene ID (NCBI): 6750 RRID: AB_2918083 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61278 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.