Proteintech, 24509-1-AP, C6orf173 Polyclonal antibody

Size: 20ul / 150ul The C6orf173 (24509-1-AP) by Proteintech is a Polyclonal antibody targeting C6orf173 in WB, ELISA applications with reactivity to human samples 24509-1-AP targets C6orf173 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells, A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21580 Product name: Recombinant human C6orf173 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-88 aa of BC046178 Sequence: MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG Predict reactive species Full Name: chromosome 6 open reading frame 173 Calculated Molecular Weight: 88 aa, 10 kDa Observed Molecular Weight: 7-10 kDa GenBank Accession Number: BC046178 Gene Symbol: C6orf173 Gene ID (NCBI): 387103 RRID: AB_2879581 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5EE01 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.