Iright
BRAND / VENDOR: Proteintech

Proteintech, 24512-1-AP, STXBP5 Polyclonal antibody

CATALOG NUMBER: 24512-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The STXBP5 (24512-1-AP) by Proteintech is a Polyclonal antibody targeting STXBP5 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 24512-1-AP targets STXBP5 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: rat brain tissue Positive IF/ICC detected in: SH-SY5Y cells, HUVEC cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Syntaxin-binding protein 5 (STXBP5, also known as tomosyn) is a cytosolic syntaxin-binding protein that can displace MUNC18 from syntaxin-1. It is a soluble R-SNARE protein that sequesters target SNAREs through the C-terminal VAMP-like domain. STXBP5 plays a regulatory role in calcium-dependent exocytosis and neurotransmitter release. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21629 Product name: Recombinant human STXBP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 515-610 aa of BC113382 Sequence: MLCIAGVSAHVIIYRFSKQEVITEVIPMLEVRLLYEINDVETPEGEQPPPLPTPVGGSNPQPIPPQSHPSTSSSSSDGLRDNVPCLKVKNSPLKQS Predict reactive species Full Name: syntaxin binding protein 5 (tomosyn) Calculated Molecular Weight: 1151 aa, 128 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC113382 Gene Symbol: STXBP5 Gene ID (NCBI): 134957 RRID: AB_2879582 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5T5C0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924