Iright
BRAND / VENDOR: Proteintech

Proteintech, 24528-1-AP, SYTL5 Polyclonal antibody

CATALOG NUMBER: 24528-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SYTL5 (24528-1-AP) by Proteintech is a Polyclonal antibody targeting SYTL5 in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 24528-1-AP targets SYTL5 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information SYTL5, also known as SLP5, is a member of the synaptotagmin-like protein (Slp) family. Members of this family are characterized by the presence of an N-terminal Slp homology domain (SHD), which functions as a Rab27-binding domain, and C-terminal tandem C2 domains, putative Ca(2+)-binding motifs. SYTL5 promotes the development and progression of papillary thyroid carcinoma (PTC) by activating the NF-κB signaling pathway (PMID: 36378561). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21698 Product name: Recombinant human SYTL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 56-343 aa of BC131585 Sequence: TQQEASRVCVHCHRNLGLIFDRGDPCQACSLRVCRECRVAGPNGSWKCTVCDKIAQLRIITGEWFFEEKAKRFKQVNVLGTDVVRQSILRRSPGAEEVQSQEQTRQDAEKSDTSPVAGKKASHDGPKRKGFLLSKFRSATRGEIITPKTDTGRSYSLDLDGQHFRSLKSPPGSDRGSTGSSDLNDQEPGPRTPKSSRSNGVTPGTQSSPAPSTRTVTSVISREYGFENSMDLAAIEGTSQELTKSHRRNTSGTPSIAVSGTSLSSDQSRSELDLSESFTEDSEDTVSI Predict reactive species Full Name: synaptotagmin-like 5 Calculated Molecular Weight: 730 aa, 81 kDa GenBank Accession Number: BC131585 Gene Symbol: SYTL5 Gene ID (NCBI): 94122 RRID: AB_3669441 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDW5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924