Iright
BRAND / VENDOR: Proteintech

Proteintech, 24533-1-AP, C13orf38 Polyclonal antibody

CATALOG NUMBER: 24533-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C13orf38 (24533-1-AP) by Proteintech is a Polyclonal antibody targeting C13orf38 in WB, ELISA applications with reactivity to human, mouse samples 24533-1-AP targets C13orf38 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CCDC169 (coiled-coil structural domain protein 169) is a member of the human genome, also known as C13orf38, and belongs to the coiled-coil structural domain protein family. Members of this family are widely involved in cellular physiological functions, including DNA recognition, chromosome segregation, and protein interactions. CCDC169 is expressed in a variety of tissues, especially in the testis, suggesting that it may be associated with reproductive processes. In addition, CCDC169 is abnormally expressed in a variety of tumors, such as lung cancer and thyroid cancer, which may be related to tumorigenesis and development. Currently, research on CCDC169 is still in progress, and its specific mechanism of action in diseases has not been fully clarified. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21598 Product name: Recombinant human C13orf38 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-241 aa of BC146975 Sequence: MKEERNYNFDGVSTNRLKQQLLEEVRKKDAVQLSIFELRHKITELEAKLNTDNEGSEWKTRYETQLELNDELEKQIVYLKEKVEKIHGNSSDRLSSIRVYERMPVESLNTLLKQLEEEKKTLESQVKYYALKLEQESKAYQKINNERRTYLAEMSQGSGLHQVSKRQQVDQLPRMQENLVKTLLLKEELDPLKVSCLETLGFSAAGVAGPENRTCLGQKALWPACLHGSSTLAVCQTHLKS Predict reactive species Full Name: chromosome 13 open reading frame 38 Calculated Molecular Weight: 241 aa, 28 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC146975 Gene Symbol: C13orf38 Gene ID (NCBI): 728591 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A6NNP5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924