Proteintech, 24553-1-AP, C15orf53 Polyclonal antibody

Size: 20ul / 150ul The C15orf53 (24553-1-AP) by Proteintech is a Polyclonal antibody targeting C15orf53 in WB, IHC, ELISA applications with reactivity to human samples 24553-1-AP targets C15orf53 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, COLO 320 cells, HepG2 cells Positive IHC detected in: human tonsillitis tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information C15orf53 has been identified on chromosome 15q14. It is probably neither causative for the etiology of BD (Bipolar disorder) nor for SCZD10 (periodic catatonia). Gene expression analysis revealed that C15orf53 was expressed in a subpopulation of leukocytes, but not in human post-mortem limbic brain tissue. In our detection this antibody always detect ~30 kDa band even the amino acids is 20 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18630 Product name: Recombinant human C15orf53 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-179 aa of BC119016 Sequence: MELQGAQEDLGISLSSPRRNHETRPGSKAKGRSSICLQASVWMAGGKLRLRASEHLTQGHQQELRDWNLGEDASLLFSKSPFGAGKLIQAPAHVFRQCWVQGNAWISCITKFDSKRSPEVASSPSYLTVPRRSPLPVFLRPSDRCVCGGCYLGKSTRRRACQSLLSDPLGVTFPTQTRP Predict reactive species Full Name: chromosome 15 open reading frame 53 Calculated Molecular Weight: 179 aa, 20 kDa Observed Molecular Weight: ~30 kDa GenBank Accession Number: BC119016 Gene Symbol: C15orf53 Gene ID (NCBI): 400359 RRID: AB_2879605 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NAA6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.