Iright
BRAND / VENDOR: Proteintech

Proteintech, 24564-1-AP, PCOTH Polyclonal antibody

CATALOG NUMBER: 24564-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PCOTH (24564-1-AP) by Proteintech is a Polyclonal antibody targeting PCOTH in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 24564-1-AP targets PCOTH in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse testis tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PCOTH may be involved in growth and survival of prostate cancer cells through the TAF-Ibeta pathway. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20092 Product name: Recombinant human PCOTH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 8-107 aa of BC142999 Sequence: GTSEEGNLLSTVSPTVKALFGKTRVSPIFPFSPRSPFQPLIPRTPGSPWGPVGPASPLGPGFPIGPMGPGKPVGPKGPMLPLGPSGPVGPTSPLFPFCP Predict reactive species Full Name: prostate collagen triple helix Calculated Molecular Weight: 107 aa, 11 kDa GenBank Accession Number: BC142999 Gene Symbol: PCOTH Gene ID (NCBI): 542767 RRID: AB_2918084 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q58A44 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924