Iright
BRAND / VENDOR: Proteintech

Proteintech, 24581-1-AP, ANKRD34B Polyclonal antibody

CATALOG NUMBER: 24581-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ANKRD34B (24581-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD34B in WB, ELISA applications with reactivity to human, mouse samples 24581-1-AP targets ANKRD34B in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse thymus tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information ANKRD34B, also named as Ankyrin repeat domain-containing protein 34B, is a 514 amino acid protein, which contains 4 ANK repeats and belongs to the ANKRD34 family. The calculated molecular weight of ANKRD34B is 55 kDa, but the phosphorylated protein is about 60-65 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20346 Product name: Recombinant human ANKRD34B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 169-425 aa of BC142957 Sequence: MPPVDIDGCHSPATCTTPSEIDIKTASSPLSHSSETELTLFGFKDLELAGSNDDTWDPGSPVRKPALAPKGPKLPHAPPWVKSPPLLMHQNRVASLQEELQDITPEEELSYKTNGLALSKRFITRHQSIDVKDTAHLLRAFDQASSRKMSYDEINCQSYLSEGNQQCIEVPVDQDPDSNQTIFASTLRSIVQKRNLGANHYSSDSQLSAGLTPPTSEDGKALIGKKKILSPSPSQLSESKELLENIPPGPLSRRNHA Predict reactive species Full Name: ankyrin repeat domain 34B Calculated Molecular Weight: 514 aa, 56 kDa Observed Molecular Weight: 55-66 kDa GenBank Accession Number: BC142957 Gene Symbol: ANKRD34B Gene ID (NCBI): 340120 RRID: AB_2879620 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A5PLL1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924