Iright
BRAND / VENDOR: Proteintech

Proteintech, 24606-1-AP, GRK1 Polyclonal antibody

CATALOG NUMBER: 24606-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GRK1 (24606-1-AP) by Proteintech is a Polyclonal antibody targeting GRK1 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse samples 24606-1-AP targets GRK1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Y79 cells, mouse eye tissue Positive IP detected in: Y79 cells Positive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse eye tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information GRK1(G protein-coupled receptor kinase 1) is also named as RHOK, RK, GPRK1, and belongs to the AGC Ser/Thr protein kinase family. It is involved in quenching of light-induced signal transduction in the phosphoreceptor. GRK1 is a photoreceptor-specific enzyme that mediates adaptation of photoreceptors to light and protects these cells against light-induced injury. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18063 Product name: Recombinant human GRK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 339-563 aa of BC140945 Sequence: AVELLDGQSKTKGYAGTPGFMAPELLQGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLRAHPLFKDLNWRQLEAGMLMPPFIPDSKTVYAKDIQDVGAFSTVKGVAFDKTDTEFFQEFATGNCPIPWQEEMIETGIFGELNVWRSDGQMPDDMKGISGGSSSSSKSGMCLVS Predict reactive species Full Name: G protein-coupled receptor kinase 1 Calculated Molecular Weight: 563 aa, 64 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC140945 Gene Symbol: GRK1 Gene ID (NCBI): 6011 RRID: AB_2879635 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15835 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924