Iright
BRAND / VENDOR: Proteintech

Proteintech, 24655-1-AP, SRA1 Polyclonal antibody

CATALOG NUMBER: 24655-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SRA1 (24655-1-AP) by Proteintech is a Polyclonal antibody targeting SRA1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 24655-1-AP targets SRA1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A2780 cells, HEK-293 cells Positive IHC detected in: human breast cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information Steroid receptor RNA activator 1 (SRA1), also known as seroid receptor RNA activator protein (SRAP) or SRA, is involved in modulating the activity of multiple transcription factors including the estrogen receptor (ER) (PMID: 20398657). It may play a role in tumorigenesis (PMID: 16152589). The SRA1 gene encodes both SRA1 protein and a non-coding functional RNA that functions as part of a ribonucleoprotein complex activating steroid receptor induced transcription. This polyclonal antibody recognizes endogenous SRA1 isoforms which migrate as a doublet on SDS-PAGE gels (PMID: 12565891; 23907597). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20082 Product name: Recombinant human SRA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-209 aa of BC067895 Sequence: GNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLF Predict reactive species Full Name: steroid receptor RNA activator 1 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 30 kDa, 33 kDa GenBank Accession Number: BC067895 Gene Symbol: SRA1 Gene ID (NCBI): 10011 RRID: AB_2879657 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HD15 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924