Proteintech, 24657-1-AP, EHD1 Polyclonal antibody

Size: 20ul / 150ul The EHD1 (24657-1-AP) by Proteintech is a Polyclonal antibody targeting EHD1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 24657-1-AP targets EHD1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, mouse brain tissue, HeLa cells, mouse testis tissue, rat lung tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: human stomach cancer tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information EHD1 (Eps15 Homology Domain Containing 1) is a protein that plays a crucial role in endocytic recycling, which is the process by which cells recycle their membrane components. It is one of four paralogs in mammals (EHD1-4) and is involved in several membrane trafficking pathways. EHD1 is particularly well-studied and is known to regulate the recycling of various cell surface receptors back to the cell surface after they have been endocytosed. This process is essential for maintaining the proper distribution of receptors and other membrane proteins, which in turn affects cellular signaling and function. EHD1 has been implicated in the regulation of the transferrin receptor (TfR), major histocompatibility complex (MHC) class I proteins, β1 integrins, and other receptors. It has also been shown to interact with Rab11-FIP2 and is localized to peripheral endosomes, suggesting a role in the transport of receptors from early endosomes to the endocytic recycling compartment (ERC). Furthermore, EHD1 has been linked to dynein motors that drive transport from early endosomes to the ERC via a complex including MICAL-L1 and the collapsin response mediator protein-2 (Crmp2). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18400 Product name: Recombinant human EHD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 353-422 aa of BC104799 Sequence: FPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQVVKGGAFDGTMNGPF Predict reactive species Full Name: EH-domain containing 1 Calculated Molecular Weight: 534 aa, 61 kDa Observed Molecular Weight: 61 kDa GenBank Accession Number: BC104799 Gene Symbol: EHD1 Gene ID (NCBI): 10938 RRID: AB_2879658 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H4M9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.