Proteintech, 24660-1-AP, OPN1SW Polyclonal antibody

Size: 20ul / 150ul The OPN1SW (24660-1-AP) by Proteintech is a Polyclonal antibody targeting OPN1SW in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 24660-1-AP targets OPN1SW in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse eye tissue, rat eye tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information OPN1SW (Short-wave-sensitive opsin 1) belongs to the G-protein coupled receptor 1 family, opsin subfamily. It's one of three types of cone photoreceptors responsible for normal color vision. Inherited tritan color vision deficiencies exhibit an autosomal dominant inheritance pattern and are caused by mutations in OPN1SW (PMID: 32400513). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20387 Product name: Recombinant human OPN1SW protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 265-348 aa of BC156719 Sequence: YAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN Predict reactive species Full Name: opsin 1 (cone pigments), short-wave-sensitive Calculated Molecular Weight: 348 aa, 39 kDa GenBank Accession Number: BC156719 Gene Symbol: OPN1SW Gene ID (NCBI): 611 RRID: AB_3085746 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P03999 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.