Proteintech, 24672-1-AP, TAF13 Polyclonal antibody

Size: 20ul / 150ul The TAF13 (24672-1-AP) by Proteintech is a Polyclonal antibody targeting TAF13 in WB, ELISA applications with reactivity to human, mouse, rat samples 24672-1-AP targets TAF13 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18193 Product name: Recombinant human TAF13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-124 aa of BC121180 Sequence: MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS Predict reactive species Full Name: TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa Calculated Molecular Weight: 124 aa, 14 kDa Observed Molecular Weight: 14-18 kDa GenBank Accession Number: BC121180 Gene Symbol: TAF13 Gene ID (NCBI): 6884 RRID: AB_2879666 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15543 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.