Proteintech, 24687-1-AP, AMMECR1 Polyclonal antibody

Size: 20ul / 150ul The AMMECR1 (24687-1-AP) by Proteintech is a Polyclonal antibody targeting AMMECR1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 24687-1-AP targets AMMECR1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, mouse liver tissue, mouse uterus tissue Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information AMMECR1 also named as AMME syndrome candidate gene 1 protein is a 333 amino acid protein, which contains 1 AMMECER1 domain. Containing a glycine-rich N terminus, the AMMECR1 protein exhibits putative nuclear localization and a substantial level of instability, suggesting it plays a role in regulation. The deletion of AMMECR1 gene may be involved in glomerulonephritis, sensorineural hearing loss, mental retardation, midface hypoplasia and elliptocytosis. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16977 Product name: Recombinant human AMMECR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-296 aa of BC060813 Sequence: MAAGCCGVKKQKLSSSPPSGSGGGGGASSSSHCSGESQCRAGELGLGGAGTRLNGLGGLTGGGSGSGCTLSPPQGCGGGGGGIALSPPPSCGVGTLLSTPAAATSSSPSSSSAASSSSPGSRKMVVSAEMCCFCFDVLYCHLYGYQQPRTPRFTNEPYALKDSRFPPMTRDELPRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGYKAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQHHHFQNGIGHPLPPYNHYS Predict reactive species Full Name: Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 Calculated Molecular Weight: 330 aa, 35 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC060813 Gene Symbol: AMMECR1 Gene ID (NCBI): 9949 RRID: AB_2879671 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y4X0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.