Iright
BRAND / VENDOR: Proteintech

Proteintech, 24688-1-AP, PRY Polyclonal antibody

CATALOG NUMBER: 24688-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PRY (24688-1-AP) by Proteintech is a Polyclonal antibody targeting PRY in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 24688-1-AP targets PRY in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PRY is Testis-specific PTP-BL-related Y protein which has two isoforms with MW 16 and 6-8 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20232 Product name: Recombinant human PRY2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-63 aa of BC153128 Sequence: MGATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFLWRY Predict reactive species Full Name: PTPN13-like, Y-linked 2 Calculated Molecular Weight: 147 aa, 17 kDa Observed Molecular Weight: 7 kDa GenBank Accession Number: BC153128 Gene Symbol: PRY Gene ID (NCBI): 442862 RRID: AB_2879672 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14603 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924