Product Description
Size: 20ul / 150ul
The C5orf26 (24698-1-AP) by Proteintech is a Polyclonal antibody targeting C5orf26 in IHC, IF/ICC, ELISA applications with reactivity to human samples
24698-1-AP targets C5orf26 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive IHC detected in: human liver cancer tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HepG2 cells, HeLa cells
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:20-1:200
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag20367 Product name: Recombinant human C5orf26 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-120 aa of BC112077 Sequence: MVQPAPPSRSRTVGPSTCRKALWDGSLSFLPFGASLLWFLLWVLWDGAWLWPRGLSRRGAGRGNAATLSLVSRLRRPVSEVSGAVNKGSGLASGLRSHVWKRGASSICVYIIDYAREFSR Predict reactive species
Full Name: chromosome 5 open reading frame 26
Calculated Molecular Weight: 120 aa, 13 kDa
GenBank Accession Number: BC112077
Gene Symbol: C5orf26
Gene ID (NCBI): 114915
RRID: AB_2879679
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924