Proteintech, 24720-1-AP, ZFP2 Polyclonal antibody

Size: 20ul / 150ul The ZFP2 (24720-1-AP) by Proteintech is a Polyclonal antibody targeting ZFP2 in WB, ELISA applications with reactivity to human, mouse samples 24720-1-AP targets ZFP2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, Neuro-2a cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20087 Product name: Recombinant human ZFP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC142989 Sequence: MEREGIWHSTLGETWEPNNWLEGQQDSHLSQVGVTHKETFTEMRVCGGNEFERCSSQDSILDTQQSIPMVKRPHNCNSHGEDATQNSELIKTQRMFVGKKIYECNQCSKTFSQSSSLLKH Predict reactive species Full Name: zinc finger protein 2 homolog (mouse) Calculated Molecular Weight: 461 aa, 53 kDa Observed Molecular Weight: 53-55 kDa GenBank Accession Number: BC142989 Gene Symbol: ZFP2 Gene ID (NCBI): 80108 RRID: AB_2879687 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZN57 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.