Proteintech, 24723-1-AP, IL-36 Gamma/IL-1F9 Polyclonal antibody

Size: 20ul / 150ul The IL-36 Gamma/IL-1F9 (24723-1-AP) by Proteintech is a Polyclonal antibody targeting IL-36 Gamma/IL-1F9 in IHC, ELISA applications with reactivity to human samples 24723-1-AP targets IL-36 Gamma/IL-1F9 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon cancer tissue, human pancreas tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information IL-36 Gamma is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21489 Product name: Recombinant human IL-1F9 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-169 aa of BC098337 Sequence: MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND Predict reactive species Full Name: interleukin 1 family, member 9 Calculated Molecular Weight: 169 aa, 19 kDa GenBank Accession Number: BC098337 Gene Symbol: IL-36 gamma/IL-1F9 Gene ID (NCBI): 56300 RRID: AB_2879690 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZH8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.