Proteintech, 24730-1-AP, HELT Polyclonal antibody

Size: 20ul / 150ul The HELT (24730-1-AP) by Proteintech is a Polyclonal antibody targeting HELT in WB, ELISA applications with reactivity to mouse, rat samples 24730-1-AP targets HELT in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: rat heart tissue, mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information HELT is a transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3'. HELT has two isoforms with MW 36 kDa and 27 kDa. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20618 Product name: Recombinant human HELT protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 54-241 aa of BC140795 Sequence: ILEMTVQYLRALHSADFPRGREKELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPPGAARSPALPYLPSAPVPLASPAQQHSPFLTPVQGLDRHYLNLIGHAHPNALNLHTPQHPPVL Predict reactive species Full Name: HES/HEY-like transcription factor Calculated Molecular Weight: 327 aa, 36 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC140795 Gene Symbol: HELT Gene ID (NCBI): 391723 RRID: AB_2879694 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A6NFD8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.