Proteintech, 24737-1-AP, C14orf159 Polyclonal antibody

Size: 20ul / 150ul The C14orf159 (24737-1-AP) by Proteintech is a Polyclonal antibody targeting C14orf159 in IHC, ELISA applications with reactivity to human samples 24737-1-AP targets C14orf159 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20681 Product name: Recombinant human C14orf159 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-85 aa of BC065558 Sequence: MPFTLHLRSRLPSAIRSLILQKKPNIRNTSSMAGELRPASLVVLPRSLAPAFERFCQVNTGPLPLLGQSEPEKWMLPPQGAISET Predict reactive species Full Name: chromosome 14 open reading frame 159 Calculated Molecular Weight: 616 aa, 66 kDa GenBank Accession Number: BC065558 Gene Symbol: C14orf159 Gene ID (NCBI): 80017 RRID: AB_2879698 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z3D6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.