Proteintech, 24764-1-AP, MINPP1 Polyclonal antibody

Size: 20ul / 150ul The MINPP1 (24764-1-AP) by Proteintech is a Polyclonal antibody targeting MINPP1 in WB, ELISA applications with reactivity to human samples 24764-1-AP targets MINPP1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, K-562 cells, PANC-1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information MINPP1 (multiple inositol-polyphosphate phosphatase 1), also known as MIPP and MINPP2, is an enzyme that catalyzes the removal of the 3-phosphate group from inositol phosphate substrates. It plays a crucial role in the metabolism of inositol polyphosphates, which are important second messengers in cellular signaling pathways. MINPP1 has been implicated in various diseases, including certain types of cancer, where its expression levels may be associated with tumor progression and differentiation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21410 Product name: Recombinant human MINPP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-339 aa of BC032504 Sequence: MLRAPGCLLRTSVAPAAALAAALLSSLARCSLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTL Predict reactive species Full Name: multiple inositol polyphosphate histidine phosphatase, 1 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC032504 Gene Symbol: MINPP1 Gene ID (NCBI): 9562 RRID: AB_3669449 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UNW1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.