Proteintech, 24775-1-AP, SLC36A1 Polyclonal antibody

Size: 20ul / 150ul The SLC36A1 (24775-1-AP) by Proteintech is a Polyclonal antibody targeting SLC36A1 in WB, IHC, ELISA applications with reactivity to human samples 24775-1-AP targets SLC36A1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20594 Product name: Recombinant human SLC36A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC136437 Sequence: MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWF Predict reactive species Full Name: solute carrier family 36 (proton/amino acid symporter), member 1 Calculated Molecular Weight: 476 aa, 53 kDa Observed Molecular Weight: 43-53 kDa GenBank Accession Number: BC136437 Gene Symbol: SLC36A1 Gene ID (NCBI): 206358 RRID: AB_2918086 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z2H8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.