Product Description
Size: 20ul / 150ul
The PRLHR (24800-1-AP) by Proteintech is a Polyclonal antibody targeting PRLHR in WB, ELISA applications with reactivity to human, rat samples
24800-1-AP targets PRLHR in WB, ELISA applications and shows reactivity with human, rat samples.
Tested Applications
Positive WB detected in: HepG2 cells, Jurkat cells, SH-SY5Y cells, rat brain tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Background Information
PRLHR (prolactin-releasing hormone receptor) is implicated in lactation, regulation of food intake, and pain-signal processing.
Specification
Tested Reactivity: human, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag20098 Product name: Recombinant human PRLHR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC101490 Sequence: MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVVVVV Predict reactive species
Full Name: prolactin releasing hormone receptor
Calculated Molecular Weight: 370 aa, 41 kDa
Observed Molecular Weight: 41 kDa
GenBank Accession Number: BC101490
Gene Symbol: PRLHR
Gene ID (NCBI): 2834
RRID: AB_3669450
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P49683
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924