Proteintech, 24801-1-AP, PXMP2 Polyclonal antibody

Size: 20ul / 150ul The PXMP2 (24801-1-AP) by Proteintech is a Polyclonal antibody targeting PXMP2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 24801-1-AP targets PXMP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat liver tissue, mouse liver tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20590 Product name: Recombinant human PXMP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 126-184 aa of BC073997 Sequence: FLIMNFLEGKDASAFAAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFANLAAL Predict reactive species Full Name: peroxisomal membrane protein 2, 22kDa Calculated Molecular Weight: 195 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC073997 Gene Symbol: PXMP2 Gene ID (NCBI): 5827 RRID: AB_2879733 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NR77 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.