Iright
BRAND / VENDOR: Proteintech

Proteintech, 24805-1-AP, ZNF391 Polyclonal antibody

CATALOG NUMBER: 24805-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF391 (24805-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF391 in IP, ELISA applications with reactivity to human, mouse samples 24805-1-AP targets ZNF391 in IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: mouse testis tissue Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information ZNF391 is involved in transcriptional regulation. The calculated MW of ZFN391 is 358aa, 41 kDa. The immunogen of this antibody is 1-128aa of human ZNF391. No other protein can be recognized by this antibody from the sequence BLAST results. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20317 Product name: Recombinant human ZNF391 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC156667 Sequence: MESLRGNTAQGPTNEEDYKNEGQLSRQTKCPAQKKSSFENTVVRKVSVTLKEIFTGEEGPESSEFSLSPNLDAQQKIPKGHGSPISRKNSKDNSDLIKHQRLFSQRKPCKCNECEKAFSYQSDLLVHS Predict reactive species Full Name: zinc finger protein 391 Calculated Molecular Weight: 3588 aa, 41 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC156667 Gene Symbol: ZNF391 Gene ID (NCBI): 346157 RRID: AB_2879736 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UJN7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924